| Name | RNF148 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6421 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | RNF148 antibody was raised using the C terminal of RNF148 corresponding to a region with amino acids PNSFTRRRSQIKTDVKKAIDQLQLRVLKEGDEELDLNEDNCVVCFDTYKP |
| Purity/Format | Affinity purified |
| Blocking Peptide | RNF148 Blocking Peptide |
| Description | Rabbit polyclonal RNF148 antibody raised against the C terminal of RNF148 |
| Gene | RNF148 |
| Supplier Page | Shop |