| Name | DPH4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4199 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | DPH4 antibody was raised using the N terminal Of Dph4 corresponding to a region with amino acids MMAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAG |
| Purity/Format | Affinity purified |
| Blocking Peptide | DPH4 Blocking Peptide |
| Description | Rabbit polyclonal DPH4 antibody raised against the N terminal Of Dph4 |
| Gene | DNAJC24 |
| Supplier Page | Shop |