LRFN3 antibody

Name LRFN3 antibody
Supplier Fitzgerald
Catalog 70R-7159
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen LRFN3 antibody was raised using the C terminal of LRFN3 corresponding to a region with amino acids VYRMIPAESRSFLLTDLASGRTYDLCVLAVYEDSATGLTATRPVGCARFS
Purity/Format Affinity purified
Blocking Peptide LRFN3 Blocking Peptide
Description Rabbit polyclonal LRFN3 antibody raised against the C terminal of LRFN3
Gene LRFN3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.