Annexin A7 antibody

Name Annexin A7 antibody
Supplier Fitzgerald
Catalog 70R-1667
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Annexin A7 antibody was raised using the N terminal of ANXA7 corresponding to a region with amino acids MSYPGYPPTGYPPFPGYPPAGQESSFPPSGQYPYPSGFPPMGGGAYPQVP
Purity/Format Total IgG Protein A purified
Blocking Peptide Annexin A7 Blocking Peptide
Description Rabbit polyclonal Annexin A7 antibody raised against the N terminal of ANXA7
Gene ANXA7
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.