| Name | Tetraspanin 33 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7544 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | Tetraspanin 33 antibody was raised using the middle region of TSPAN33 corresponding to a region with amino acids LQLAAGILGFVFSDKARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKFSC |
| Purity/Format | Affinity purified |
| Blocking Peptide | Tetraspanin 33 Blocking Peptide |
| Description | Rabbit polyclonal Tetraspanin 33 antibody raised against the middle region of TSPAN33 |
| Gene | TSPAN33 |
| Supplier Page | Shop |