C9ORF75 antibody

Name C9ORF75 antibody
Supplier Fitzgerald
Catalog 70R-3687
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen C9ORF75 antibody was raised using the middle region of C9Orf75 corresponding to a region with amino acids PPFLPAASEEAEPAEGLRVPGLAKNSREYVRPGLPVTFIDEVDSEEAPQA
Purity/Format Affinity purified
Blocking Peptide C9ORF75 Blocking Peptide
Description Rabbit polyclonal C9ORF75 antibody raised against the middle region of C9Orf75
Gene TPRN
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.