| Name | ZP4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7191 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ZP4 antibody was raised using the N terminal of ZP4 corresponding to a region with amino acids MWLLRCVLLCVSLSLAVSGQHKPEAPDYSSVLHCGPWSFQFAVNLNQEAT |
| Purity/Format | Affinity purified |
| Blocking Peptide | ZP4 Blocking Peptide |
| Description | Rabbit polyclonal ZP4 antibody raised against the N terminal of ZP4 |
| Gene | ZP4 |
| Supplier Page | Shop |