MVP antibody

Name MVP antibody
Supplier Fitzgerald
Catalog 70R-2052
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen MVP antibody was raised using the N terminal of MVP corresponding to a region with amino acids MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRM
Purity/Format Affinity purified
Blocking Peptide MVP Blocking Peptide
Description Rabbit polyclonal MVP antibody raised against the N terminal of MVP
Gene PTPRA
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.