Name | PIGQ antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6645 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | PIGQ antibody was raised using the N terminal of PIGQ corresponding to a region with amino acids VLHFPFIPIQVKQLLAQVRQASQVGVAVLGTWCHCRQEPEESLGRFLESL |
Purity/Format | Affinity purified |
Blocking Peptide | PIGQ Blocking Peptide |
Description | Rabbit polyclonal PIGQ antibody raised against the N terminal of PIGQ |
Gene | PIGQ |
Supplier Page | Shop |