NBEAL1 antibody

Name NBEAL1 antibody
Supplier Fitzgerald
Catalog 70R-4615
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen NBEAL1 antibody was raised using the N terminal of NBEAL1 corresponding to a region with amino acids KDNDKNMSTEDTKKNSDEKTDEEKITSFASANVSSDQWSLEDRHSLDSNT
Purity/Format Affinity purified
Blocking Peptide NBEAL1 Blocking Peptide
Description Rabbit polyclonal NBEAL1 antibody raised against the N terminal of NBEAL1
Gene NBEAL1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.