Name | BSDC1 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1153 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | IHC WB |
Species Reactivities | Human, Mouse, Rat, Dog, Zebrafish |
Antigen | BSDC1 antibody was raised using the N terminal of BSDC1 corresponding to a region with amino acids VISDTFAPSPDKTIDCDVITLMGTPSGTAEPYDGTKARLYSLQSDPATYC |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | BSDC1 Blocking Peptide |
Description | Rabbit polyclonal BSDC1 antibody raised against the N terminal of BSDC1 |
Gene | BSDC1 |
Supplier Page | Shop |