| Name | MOGAT1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6677 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | MOGAT1 antibody was raised using the C terminal of MOGAT1 corresponding to a region with amino acids PIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK |
| Purity/Format | Affinity purified |
| Blocking Peptide | MOGAT1 Blocking Peptide |
| Description | Rabbit polyclonal MOGAT1 antibody raised against the C terminal of MOGAT1 |
| Gene | MOGAT1 |
| Supplier Page | Shop |