| Name | CYP4F12 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7260 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CYP4F12 antibody was raised using the C terminal of CYP4F12 corresponding to a region with amino acids TVWPDPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVV |
| Purity/Format | Affinity purified |
| Blocking Peptide | CYP4F12 Blocking Peptide |
| Description | Rabbit polyclonal CYP4F12 antibody raised against the C terminal of CYP4F12 |
| Gene | CYP4F12 |
| Supplier Page | Shop |