C2ORF42 antibody

Name C2ORF42 antibody
Supplier Fitzgerald
Catalog 70R-3948
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen C2ORF42 antibody was raised using the N terminal Of C2Orf42 corresponding to a region with amino acids EPNSLRTKVPAFLSDLGKATLRGIRKCPRCGTYNGTRGLSCKNKTCGTIF
Purity/Format Affinity purified
Blocking Peptide C2ORF42 Blocking Peptide
Description Rabbit polyclonal C2ORF42 antibody raised against the N terminal Of C2Orf42
Gene C2orf42
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.