| Name | Ctp Synthase antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1030 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | Ctp Synthase antibody was raised using the N terminal of CTPS corresponding to a region with amino acids SMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELR |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | Ctp Synthase Blocking Peptide |
| Description | Rabbit polyclonal Ctp Synthase antibody raised against the N terminal of CTPS |
| Gene | CTPS1 |
| Supplier Page | Shop |