| Name | FBP1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1222 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse |
| Antigen | FBP1 antibody was raised using the N terminal of FBP1 corresponding to a region with amino acids YVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAA |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | FBP1 Blocking Peptide |
| Description | Rabbit polyclonal FBP1 antibody raised against the N terminal of FBP1 |
| Gene | FBP1 |
| Supplier Page | Shop |