Name | PNMA3 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3050 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | PNMA3 antibody was raised using the middle region of PNMA3 corresponding to a region with amino acids RITGVGAVPLPASGNSFDVRPSQGYRRRRGRGQHRRGGVARAGSRGSRKR |
Purity/Format | Affinity purified |
Blocking Peptide | PNMA3 Blocking Peptide |
Description | Rabbit polyclonal PNMA3 antibody raised against the middle region of PNMA3 |
Gene | PNMA3 |
Supplier Page | Shop |