| Name | ACADVL antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2313 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | ACADVL antibody was raised using the N terminal of ACADVL corresponding to a region with amino acids RPYAGGAAQESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPV |
| Purity/Format | Affinity purified |
| Blocking Peptide | ACADVL Blocking Peptide |
| Description | Rabbit polyclonal ACADVL antibody raised against the N terminal of ACADVL |
| Gene | ACADVL |
| Supplier Page | Shop |