| Name | HNRPK antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1319 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog, Zebrafish |
| Antigen | HNRPK antibody was raised using the C terminal of HNRPK corresponding to a region with amino acids YSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGAS |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | HNRPK Blocking Peptide |
| Description | Rabbit polyclonal HNRPK antibody raised against the C terminal of HNRPK |
| Gene | HNRNPK |
| Supplier Page | Shop |