| Name | FAM105A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6746 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FAM105A antibody was raised using the N terminal of FAM105A corresponding to a region with amino acids HKLKWWIGYLQRKFKRNLSVEAEVDLLSYCAREWKGETPRNKLMRKAYEE |
| Purity/Format | Affinity purified |
| Blocking Peptide | FAM105A Blocking Peptide |
| Description | Rabbit polyclonal FAM105A antibody raised against the N terminal of FAM105A |
| Gene | FAM105A |
| Supplier Page | Shop |