| Name | MARVELD3 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6394 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Dog |
| Antigen | MARVELD3 antibody was raised using the middle region of MARVELD3 corresponding to a region with amino acids SYFVLAGFSASFSSGGGFGNNYYSPFEGTELEQVRQLDQQYTILRSPLIY |
| Purity/Format | Affinity purified |
| Blocking Peptide | MARVELD3 Blocking Peptide |
| Description | Rabbit polyclonal MARVELD3 antibody raised against the middle region of MARVELD3 |
| Gene | MARVELD3 |
| Supplier Page | Shop |