Name | FAM46D antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4172 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | FAM46D antibody was raised using the middle region of FAM46D corresponding to a region with amino acids LPNTQKVTCFYQPAPYFAAEARYPIYVIPEPPPVSFQPYHPLHFRGSNGM |
Purity/Format | Affinity purified |
Blocking Peptide | FAM46D Blocking Peptide |
Description | Rabbit polyclonal FAM46D antibody raised against the middle region of FAM46D |
Gene | FAM46D |
Supplier Page | Shop |