| Name | FAM46D antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4172 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FAM46D antibody was raised using the middle region of FAM46D corresponding to a region with amino acids LPNTQKVTCFYQPAPYFAAEARYPIYVIPEPPPVSFQPYHPLHFRGSNGM |
| Purity/Format | Affinity purified |
| Blocking Peptide | FAM46D Blocking Peptide |
| Description | Rabbit polyclonal FAM46D antibody raised against the middle region of FAM46D |
| Gene | FAM46D |
| Supplier Page | Shop |