UROD antibody

Name UROD antibody
Supplier Fitzgerald
Catalog 70R-1254
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications IHC WB
Species Reactivities Human
Antigen UROD antibody was raised using the N terminal of UROD corresponding to a region with amino acids SLLLLLFLFIVIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQV
Purity/Format Total IgG Protein A purified
Blocking Peptide UROD Blocking Peptide
Description Rabbit polyclonal UROD antibody raised against the N terminal of UROD
Gene UROD
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.