| Name | IGF2BP1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4908 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | IGF2BP1 antibody was raised using the N terminal of IGF2BP1 corresponding to a region with amino acids PDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRLLVPT |
| Purity/Format | Affinity purified |
| Blocking Peptide | IGF2BP1 Blocking Peptide |
| Description | Rabbit polyclonal IGF2BP1 antibody raised against the N terminal of IGF2BP1 |
| Gene | IGF2BP1 |
| Supplier Page | Shop |