HIRIP3 antibody

Name HIRIP3 antibody
Supplier Fitzgerald
Catalog 70R-2185
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen HIRIP3 antibody was raised using the middle region of HIRIP3 corresponding to a region with amino acids RTRSSSSSSDGSPEAKGGKAGSGRRGEDHPAVMRLKRYIRACGAHRNYKK
Purity/Format Affinity purified
Blocking Peptide HIRIP3 Blocking Peptide
Description Rabbit polyclonal HIRIP3 antibody raised against the middle region of HIRIP3
Gene HIRIP3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.