Name | SDSL antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-2922 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | SDSL antibody was raised using the middle region of SDSL corresponding to a region with amino acids ALAAIYSGLLRRLQAEGCLPPSLTSVVVIVCGGNNINSRELQALKTHLGQ |
Purity/Format | Affinity purified |
Blocking Peptide | SDSL Blocking Peptide |
Description | Rabbit polyclonal SDSL antibody raised against the middle region of SDSL |
Gene | SDSL |
Supplier Page | Shop |