| Name | FAM121B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1479 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FAM121B antibody was raised using the C terminal Of Fam121B corresponding to a region with amino acids LYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | FAM121B Blocking Peptide |
| Description | Rabbit polyclonal FAM121B antibody raised against the C terminal Of Fam121B |
| Gene | APOO |
| Supplier Page | Shop |