| Name | Osteomodulin antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6074 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | Osteomodulin antibody was raised using the middle region of OMD corresponding to a region with amino acids LLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTNAMDGLVNLTMLD |
| Purity/Format | Affinity purified |
| Blocking Peptide | Osteomodulin Blocking Peptide |
| Description | Rabbit polyclonal Osteomodulin antibody raised against the middle region of OMD |
| Gene | OMD |
| Supplier Page | Shop |