Name | D15WSU75E antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3435 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | D15WSU75E antibody was raised using the middle region of D15Wsu75E corresponding to a region with amino acids FLTGRKIPSYITDLPSEVLSTPFGQALRPLLDSIQIQPPGGSSVGRPNGQ |
Purity/Format | Affinity purified |
Blocking Peptide | D15WSU75E Blocking Peptide |
Description | Rabbit polyclonal D15WSU75E antibody raised against the middle region of D15Wsu75E |
Gene | DESI1 |
Supplier Page | Shop |