| Name | C9ORF127 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7003 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Dog |
| Antigen | C9ORF127 antibody was raised using the N terminal Of C9Orf127 corresponding to a region with amino acids MNMPQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFS |
| Purity/Format | Affinity purified |
| Blocking Peptide | C9ORF127 Blocking Peptide |
| Description | Rabbit polyclonal C9ORF127 antibody raised against the N terminal Of C9Orf127 |
| Gene | TMEM8B |
| Supplier Page | Shop |