| Name | PCBP3 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4780 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | PCBP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids QTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTI |
| Purity/Format | Affinity purified |
| Blocking Peptide | PCBP3 Blocking Peptide |
| Description | Rabbit polyclonal PCBP3 antibody |
| Gene | PCBP3 |
| Supplier Page | Shop |