Name | OLFML2B antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6458 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | OLFML2B antibody was raised using the N terminal of OLFML2B corresponding to a region with amino acids EEVSKNLTKENEQIKEDMEEIRTEMNKRGKENCSENILDSMPDIRSALQR |
Purity/Format | Affinity purified |
Blocking Peptide | OLFML2B Blocking Peptide |
Description | Rabbit polyclonal OLFML2B antibody raised against the N terminal of OLFML2B |
Gene | OLFML2B |
Supplier Page | Shop |