| Name | LARP4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4972 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | LARP4 antibody was raised using the middle region of LARP4 corresponding to a region with amino acids VSPTKNEDNGAPENSVEKPHEKPEARASKDYSGFRGNIIPRGAAGKIREQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | LARP4 Blocking Peptide |
| Description | Rabbit polyclonal LARP4 antibody raised against the middle region of LARP4 |
| Gene | LARP4 |
| Supplier Page | Shop |