| Name | PCDHGC3 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6138 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PCDHGC3 antibody was raised using the N terminal of PCDHGC3 corresponding to a region with amino acids ISEAVAPGTRFPLESAHDPDVGSNSLQTYELSRNEYFALRVQTREDSTKY |
| Purity/Format | Affinity purified |
| Blocking Peptide | PCDHGC3 Blocking Peptide |
| Description | Rabbit polyclonal PCDHGC3 antibody raised against the N terminal of PCDHGC3 |
| Gene | PCDHG@ |
| Supplier Page | Shop |