Name | KIAA1024 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6874 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | KIAA1024 antibody was raised using the C terminal of KIAA1024 corresponding to a region with amino acids DNKDWHRKSKEADRQYDIPPQHRLPKQPKDGFLVEQVFSPHPYPASLKAH |
Purity/Format | Affinity purified |
Blocking Peptide | KIAA1024 Blocking Peptide |
Description | Rabbit polyclonal KIAA1024 antibody raised against the C terminal of KIAA1024 |
Gene | KIAA1024 |
Supplier Page | Shop |