| Name | MIF4GD antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1452 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | MIF4GD antibody was raised using the C terminal of MIF4GD corresponding to a region with amino acids LFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | MIF4GD Blocking Peptide |
| Description | Rabbit polyclonal MIF4GD antibody raised against the C terminal of MIF4GD |
| Gene | MIF4GD |
| Supplier Page | Shop |