| Name | NXF1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4657 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Dog |
| Antigen | NXF1 antibody was raised using the N terminal of NXF1 corresponding to a region with amino acids RPNRRGDTWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWFKITIPYG |
| Purity/Format | Affinity purified |
| Blocking Peptide | NXF1 Blocking Peptide |
| Description | Rabbit polyclonal NXF1 antibody raised against the N terminal of NXF1 |
| Gene | NXF1 |
| Supplier Page | Shop |