MAGEA10 antibody

Name MAGEA10 antibody
Supplier Fitzgerald
Catalog 70R-3921
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen MAGEA10 antibody was raised using the middle region of MAGEA10 corresponding to a region with amino acids NMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGP
Purity/Format Affinity purified
Blocking Peptide MAGEA10 Blocking Peptide
Description Rabbit polyclonal MAGEA10 antibody raised against the middle region of MAGEA10
Gene MAGEA10
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.