| Name | IL8RB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5941 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | IL8RB antibody was raised using the N terminal of IL8RB corresponding to a region with amino acids MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYF |
| Purity/Format | Affinity purified |
| Blocking Peptide | IL8RB Blocking Peptide |
| Description | Rabbit polyclonal IL8RB antibody raised against the N terminal of IL8RB |
| Gene | CXCL8 |
| Supplier Page | Shop |