| Name | SLC22A23 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1742 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | SLC22A23 antibody was raised using the middle region of SLC22A23 corresponding to a region with amino acids VVLCVNSLTGYGIHHCFARSMMGHEVKVPLLENFYADYYTTASIALVSCL |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | SLC22A23 Blocking Peptide |
| Description | Rabbit polyclonal SLC22A23 antibody raised against the middle region of SLC22A23 |
| Gene | SLC22A23 |
| Supplier Page | Shop |