Name | PPP3CA antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4113 |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | PPP3CA antibody was raised using a synthetic peptide corresponding to a region with amino acids LPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINE |
Purity/Format | Affinity purified |
Blocking Peptide | PPP3CA Blocking Peptide |
Description | Rabbit polyclonal PPP3CA antibody |
Gene | PPP3CA |
Supplier Page | Shop |