| Name | DDX19B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1388 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog, Zebrafish |
| Antigen | DDX19B antibody was raised using a synthetic peptide corresponding to a region with amino acids GKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTG |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | DDX19B Blocking Peptide |
| Description | Rabbit polyclonal DDX19B antibody |
| Gene | DDX19B |
| Supplier Page | Shop |