IL28R alpha antibody

Name IL28R alpha antibody
Supplier Fitzgerald
Catalog 70R-7458
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen IL28R alpha antibody was raised using a synthetic peptide corresponding to a region with amino acids QDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRV
Purity/Format Affinity purified
Blocking Peptide IL28R alpha Blocking Peptide
Description Rabbit polyclonal IL28R alpha antibody
Gene IFNLR1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.