| Name | RAGE antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4337 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | RAGE antibody was raised using the N terminal of RAGE corresponding to a region with amino acids MKQRFESIEQVNNLREIQALRRLNPHPNILMLHEVVFDRKSGSLALICEL |
| Purity/Format | Affinity purified |
| Blocking Peptide | RAGE Blocking Peptide |
| Description | Rabbit polyclonal RAGE antibody raised against the N terminal of RAGE |
| Gene | MOK |
| Supplier Page | Shop |