| Name | C21ORF62 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5266 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C21ORF62 antibody was raised using the middle region of C21Orf62 corresponding to a region with amino acids STNTLPTEYLAICGLKRLRINMEAKHPFPEQSLLIHSGGDSDSREKPMWL |
| Purity/Format | Affinity purified |
| Blocking Peptide | C21ORF62 Blocking Peptide |
| Description | Rabbit polyclonal C21ORF62 antibody raised against the middle region of C21Orf62 |
| Gene | C21orf62 |
| Supplier Page | Shop |