| Name | SLC25A36 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6399 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | SLC25A36 antibody was raised using the N terminal of SLC25A36 corresponding to a region with amino acids SSSVTLYISEVQLNTMAGASVNRVVSPGPLHCLKVILEKEGPRSLFRGLG |
| Purity/Format | Affinity purified |
| Blocking Peptide | SLC25A36 Blocking Peptide |
| Description | Rabbit polyclonal SLC25A36 antibody raised against the N terminal of SLC25A36 |
| Gene | SLC25A36 |
| Supplier Page | Shop |