| Name | GHRHR antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6006 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | GHRHR antibody was raised using the N terminal of GHRHR corresponding to a region with amino acids VTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEEE |
| Purity/Format | Affinity purified |
| Blocking Peptide | GHRHR Blocking Peptide |
| Description | Rabbit polyclonal GHRHR antibody raised against the N terminal of GHRHR |
| Gene | GHRHR |
| Supplier Page | Shop |