| Name | Syntaxin 19 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3408 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | Syntaxin 19 antibody was raised using the N terminal of STX19 corresponding to a region with amino acids LQQAVIYEREPVAERHLHEIQKLQESINNLADNVQKFGQQQKSLVASMRR |
| Purity/Format | Affinity purified |
| Blocking Peptide | Syntaxin 19 Blocking Peptide |
| Description | Rabbit polyclonal Syntaxin 19 antibody raised against the N terminal of STX19 |
| Gene | STX19 |
| Supplier Page | Shop |