Name | CCDC87 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4369 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | CCDC87 antibody was raised using the N terminal of CCDC87 corresponding to a region with amino acids MMEPPKPEPELQRFYHRLLRPLSLFPTRTTSPEPQKRPPQEGRILQSFPL |
Purity/Format | Affinity purified |
Blocking Peptide | CCDC87 Blocking Peptide |
Description | Rabbit polyclonal CCDC87 antibody raised against the N terminal of CCDC87 |
Gene | CCDC87 |
Supplier Page | Shop |