| Name | ANTP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2190 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Drosophila |
| Antigen | ANTP antibody was raised using the C terminal Of Antp corresponding to a region with amino acids QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH |
| Purity/Format | Affinity purified |
| Blocking Peptide | ANTP Blocking Peptide |
| Description | Rabbit polyclonal ANTP antibody raised against the C terminal Of Antp |
| Gene | Antp |
| Supplier Page | Shop |